=^@ &f)eB J%@& fE7 ʋ, A6w 4Ά zVHANDL-F-Window errorf 9^^ 0 4 6 =@ @  G` N Z e q u  @  @ . < `J `X X _ `_ \`_ `_ *a_ , w0<  w"\. wD< wL J wd<X wl4f wt$Dt w, w4 w< w|TL w\T wdd wzl wl|l w^t wPtwB|w4w&D*wL8w   R . F B< 6 ,:&f&  & 杸  @ ^a[W T & Ne N`f A N`f  mz_ & e & e `` V`E? `E& e ($[em & e f  & Ne &  @ &  A C &     `x  ff& e De5.fffffT% e  f|   f @e AWAWZ@ eVq Tew SPACK - ׭12׭3 E& Ne &   E& Ne & n E& e X& & B  5 &f&B   *&& N b "f % ŀw  &f %SIRCGf&7 4 4   w4  ^ k kwВEw`S& N 4   4 NwXEwCS& N r=w6Ew2St  (44B  :!& N  w-XRS    :  A TT ef SEwHS& N _f j ?Ew4S& N E`t& @` E? `E NEw S& N B TA1 14f&  % % 5.w0fff e f& ") e &f b% 4 4 4 4 4 4 4 4 4 @  @   4  ݅ 7 ݓ  4A111   fAZ@ eq ew 5ff& &&(* e RPACK - &4-=5 90& *f #@ `f& &f 0!eef& &f !ee @ f&f ee0?Bad Checksum: rcv,calc are  5wЈE& N ׭.1& E& N C׭3 n E& N CС׭ E&f 6 ׭3  f& X%!  ׭EE`B׭`2 E? B`EE f&f CD( ׭(E&N@@UB EE A,d,N@Ld,UEf@@@U !1BRcs ƍ#2$FW6etHZӾl~&frlJ Rb   TtrlJ Rb   7 7 7 7 7 7 7 7 7 7 7 7  J b" w "f& ߖ%E W  w  5 d &f @ 6 &f7 ץ~ 7 7 8  77rj&fD  R 2A F 07 *7 w w-^ w --  X ԝ & e  27       ԝ ŀ BE   VV RNԝ  & N h& ^ T &   ŀ edw ^ v &fDE  A. BE =ԝ7 1 & N &  RT & ^ χ f&BC Y  &7"  E&  7 7 7  Ew} W?W_&   Հ&    ew  &B D 7  Ew&  |   &ffA   -ԕ TC̔ $̕_ ԕ    2f&&6E eeVf& R2 ef& f e 7 ܇Aborting with error from remote. && NffNO&UO e  &׭ fO % ffO %&fzO %ffHL e 2   )&f`& <֖%HfH x% ff` e&@@E@U6 ʋ  % jb^f Ef@@@U Ef@@@UE7ۀ &f  Ov ՀŀE4ՀE4Հ^8Rt ]5 f& JP e눷X(h(eb(7 7 7 5j(f&  Q Be BwH&5 P P 7 f& Q eR4R&6R ]0  R'f& 7Q ef`  f& |P Ref& ` >ef& 4Q *e&]]]-&&-&& f& P e7 & ZfAC7  L zsUP@= f7fF#ff   ( Hp3NU&U3 :U O OP P* `@edf&C(7  V sUP@= f7fF- ff ,  .  Hp03 &U:U O OPO* `@ed&f3 NU3 &U3 0U3 :U3 DUUUUTTU A ANU f TA @* O 1 &U1 NU@ &U0 0U0 DU & C W @ p W W W  S  W fBCA  "f e    W,U  @    ,U  0U,&UU HDUT0  DU2 &U 20UTl&U Ҳ &U 0U * PfA @ f&B ,&UU3U ,U fUT e HDUT00  DU2 &UTU &UlT &U * PfA &U% :U" BU  HpDUpT0  ff&UfT 0e ftA & ff P &fABBҋB ]ыP  Е] fe f& l< e @ȋ %* p fA<f ́ @@`&& p *  P% HЕBЕYЕEU$  ff v  @  @ @f=& NCan't do REMOTE LOGIN for RT11 @ ( - @ 7  OP* efH R H B  f& FR e 7 <"7 D7 B rfH  v 7    ׭   ' Nw w f& > Re  f& ? 6e  Nf > 7 8 w7 tϝUnrecognized command %Command not unique, try longer spelling R && f fR  f? % f? % ϾR Receive complete Receive failed R R7 ` Rf  vɋ R * R " [  f<υ d 7ɋW R W  f   f 4 f  n !fS T  f@ l% f@ V% R ^ 7ЇSend complete Send failed 42 * f z f e f f t ؇&f ˖%f 7 ؀ f h wR r  JƇR ^  .ƇR J *7 ɋf !fv fv  fXB % R 7tχGet from server aborted S ŇS ŇS fv  S fv S pfv n S Vfv \ S  Q Zff F%  v 4sf& f efff eXS [ \S & b  vS S f ~ 7 7 p7 p b ,ff ~  w>B@f& f ef  ff  S  f&v "%  f&v Pe  S v' f&v %  f&v e S S ~vt  1%16385."DA1%65537fE fE S 07^ 7X7 &f& % 3 0ff& e 0& f&& %w7 f&& e ɇf 7 LAf& @`&v d8C  xÃCmˋ*f&  efv    4ffv e 0v@&7 & A@ oW?7DS (f& f `ef& jH Leɋ f& & 0eS je In < nH& N   'D ! ff&& 4e   e    0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ-@_.- fH `  Ƈ v S rS jw&f`& %f& ` eS 0 fvʋI ʋ  & v& 2v& & f& I ef f  ff >e `& v  To: vɋW  f&f BAt4 4 u CM5ŀ5 5נ Õ   נ .נ +E5 $KË ȋР5 נzנa 5@ נ[Õ(נ]Õ)5 נ'נ"45נ ËҐ 5 `W W  e  &Ћ f&fA DeEff F 6f&f eF`%f& ff e&f&BC ҕ A  f e0 b    - A   ѕ ʕ*  &f& & ef&@ABD  &f   e  &fAC @f ʽL (f LSL ABCDEFGHIJKLMNOPQRSTUVWXYZ$.?0123456789: C& ˋ)ע  @ ע+ע-ע0ע9& 0 f e     U   Bנ0 נ70 `&fBCeEbN E 01234567&ff& %f& ee&f   !e&f  f& & %  %fP%fЋ P% ы % E&m̗#ṁ̷ Kermit: pak: Fubar pak type: Retry limit reachedHopelessly out of synch with sending KermitRetry limit reached, parity is possibly being introducedV4d4t4X4^4V4Kermit-11 may not run correctly on a SJ monitor RT-11 default terminal line set to unit This system does not appear to have a line clock. Kermit-11 may not run correctly. XC0:PRO/350 comm port set to XC0: TSX-Plus remote mode This system lacks both XC and XL drivers, and has not been generated for Multiple Terminal support. Only the CONSOLE will be usable for Kermit. Eight bit prefixing support will be required of the other Kermit for the transfer of binary files. xDK:S Check SHOW RELEASE_NOTES for possible incompatabilities with previous releases of Kermit-11 and other Kermits. REC SEN?Syntax SEND Filename.type BYEFINGET SPAHELHOSRDITYPWHODELCWDLOGRENCOPKERMIT is not running as a LOCAL Kermit Read error on TAKE file: Current TAKE file closed LOCREMUnrecogized REMOTE command Exiting due to control C interupt SSSSSSSSSSSSSSSSS%T*.* \U~UWY[\U~UWY[   Last edit: 24-Mar-86 (Long Packet Support) 1Tff0   rp * :Pf 4 p f DA 1ffpfp(EU@PUpff L%   * :Pg0 f Dp * :Pf (pק*0 pp * :P p&& & & C ÜfW-07  ;A<f 0  F &   %g  * :Pef&f ABYfD ff e I f<f035@ E@f0p0cccc0 * :Pef@ ,0  f 0`@ȋ09ff0   w  m  e\dAɔW  є AR  0 1 2 3 4 5 6 7 8 9101112131415161718 p f f7p-fef ֨(pfpEPp * :Pf \(pfpE f fef  * :P U@$E$AP       ѕ ѕ A U@P$ E@P$ ff ff2f le fff efff 8e 2Kn,X`  %  f'# f7 f l;U@P$ 77777777f 4c eff %   *c0 f$ f$Hc  f@c e &U$& & CW- A<f "  ,cef AB@   f@ ,0  f 0`@ȋ09@Е0 f f  U@$E@$AP       ѕ ѕ A $U@P$ EU$ 2Kn,X`  % SWUYRTXZPffA  tlf& ll e f&A@ pVipWi ɋgWTd7  l lB  \Pf   F7 NiH'  0 0 0 0  D ^׭D: ,P0P * `@A 1 Vi حO-7 7 7 7 7 7 7 7 7 f& `l ze 0 vl0  0 xl0 U@P$f (W:R   .b.b  bvbe(e(HbKbNbRbVbZb^bbbfbjbnbrbXCXLXC0XL0CL0CL1CL2CL3CL4CL5CL6CL7xxf8i \ 0 zl0 7 A WViCWViX4   0 0  0  @@ 7 07 *l ?1 Vi   Ni 0 0 0   $ 7 ni0 7 &B ViCViX -p^lh l`?\   N J C <   iHl@d  0 &   %Di   R7  W-  U@P$W- A<f J Di   E@P$f& rD ViT DB  aCziDҔ D ר ҕ 7  ҕ   i HzipRfX Di  |   Tff   p. 0 0 0 Hi 0 0   @ȕT7ȕT7ȕ:7ܯ7ׯ @f |l2,|l A *ff F  p el 0 0   U@P$ E@P$ U@$ DE@$E$AP       ѕ ѕ A <xlSWUYRTXZP(Kn,X`  %K x~ 0 6f&v @ǖ% f&v pe    ˷   ˷ 䍇 ڍ &  7  ˇă tȃ lf& t e܃ Pfv ,% & LJf  fv R% & tf ʎ    7 f 7 & ށt fv e b& 7 V& ft jeSY:*.CMD J  B: :ʇv evЕ P > f& & Ȗ%\ ` ɇvZ\^ŀ d ҺPff ƺ f& f peh ePl f&v % <f& & ,ep f fv Je B Zf& V%  ff& иet   & f Ƶ efv %& ^ŇSETInvalid value for SET Unknown/invalid Set command CON DIRCurrent default is TAKEPrevious TAKE file closed SYSThe SYSTEM command requires a command to execute Error from spawning command SPA TYP w617 7 7 7 ,m*ԗw Ηmȗ h׭Ǚ1׭1S  7 ʙ @΀& ݴ  ؀w1&  : f \  XABCDFSZH@ $,E "eA     V 5(ā ѝԘѕ ff& Bee( hf& ā Zef< De ZSendsw - state is X-TFA K z<fH e + )ffA effN J%BCAe& N @ f x wėDENYT܂AwHfN n A ? nlw  XV7 HD  @ .H - A |)fB effN 8%BCAe& N . ENYT΃AfN x A ?xv  fd7 VR  @ <C&f&f7 7 I S 1ފ֊ -ޕЊA B<f l f 舖%ff effN ء%BCAe& N ή DBENYT"bA8WI fN AWI-  @ Tꔃ7 ޔFܔ ҔДfN p% xu#m7   @ 脃~ F;XTP0JTPH7 N @ :-6(A wl 0 f 7 } *fH ֶ% ޓfؓH ԰e f`& %fH` eAl >fH 8%f&H Ɓ% Zf&H (e  "f&&&F e7f:OX effN :%BCAe& N 0 e@ENYṪ懰Sending file as file AfN ` A ? `^  NL7 >:  @ $H ( f ¥ wD -܆A N)fґD effN %BCAe& N ENYT\\׭l Pf &RE 6eAf:O.N eExpecting ACK, packet type not valid in current SDATA state -^ f %fN 7 ?  7 xve7 ZV  @ @ :* T (Z f:OE e7 A׭X׭ZZmΏVw Pf h wZD -A < ~fDpZ Tef:OPZ 4effN %BCAe2& N ~ 87 ENYTFRd~LLDA쎇fN Ħ  ? ȎƎ  7   @ ~f b 7 ~-  v & FBLONG Packet size reduced, first data packet failed $7 2w27 L 1 7 7 mЗw ʗmė h7  Ь  @ԙ& ʙ . 1&  T f v 7 nRFDCA@΀Ҁހ wb wV `wJ & &f&&(E eControl C abort on file receivef( ѝޘѕ 5 ff& De n ff& be   de(Recsw - state is & ^-ZL °Aff %BCAe$& N *SET4nX44f:ON ڠe旇f Af p%f P fY ~e7 |x  @ ̇b ʪF& ޅ2.*0$.* *-& A  &Xff X%BCAed& N N nSZFBEXTbƄ؃慀f:ON e  6Af:OvY ZeCf > A D-@0 A0e? @f  f fY ޞe7 敇 A Е-̕ 2Ae? @f  f:OY ze7 ~ A n Af ƃ% f… efH % 5 f 7 f:OY НeԔԔ7 Δʔ  @ Df`& 胖%f&`Ӆ eA was renamed to RMS $PARSE failed NAf:O8Y e7 7 (,7   @ ^D&7 ֓-ғĈ :Aff %BCAe& N  ADEFZXTȆf|tt |N nK @I& f&H 0e 6fH efY e  @ L⒃7 ֒ܒDUHV f& T% f& be7"p f`& ā%f&` eAf& %f&҉ e* 2 - xAe? @f T f:OY e7 đȑ jA`Nw Hf t% f`& ؀%f` ek j@ + &2f<Y e1fY e!f:OE e7 (f:OؐY e7   @ DALocal KERMIT error: ZXCreate failed - Created file - File exists, not superceded - 0-, Ae? @f n f:OY ژe7 ޏ⏇ Af A- ^A   f z  ~7 f:OY `edd7 ^Z  @ DF7 F N-J38 f8&E eAExpecting ACK, packet type not valid in current RDATA statef:ON e 0 - Ae? @f ~ f:OY >e7 BFAf |  (f:OY e7   @ J~܍AAttribute packet error - *v 0v f `l  V & f 7 yf 0m yf $m &  t   mA f&  2ef l   X ƪ Nf& & 8%f 6m  Ҫ   fv   @ff Rle  & d 2 $v6 V fv % f&v Ԥe  t 5v Z F > E?u5uf Eu 2l  E?u  U?u u 7 u pUru ` U\u J UFu 4 tU0u /"uE  ^ث V U uf f: eܫ   5 t  H Ut L ިP ֨\ Ψ` ƨ        > ~B vF n| f ^ V Nȭ F̭ >fv H% ( 7k Э   @ D z ~  ا  ̧ ħ v'" f& %  7Jj  b> ffv P%  j7 ifv &%  iii ޮ ܦ7 ii7i Ħ 7 h7 h  c7 Bi fv f  w&i fv z%  i 7 i vȋ 0W wh  J  WD7 hWAhhN n ڥ fv ⠖%  ɋ ff  wr  ɋWO  WF7s  ` X TɋWSWL7g į & s 7 s 7 vs f:v %  7Ts fjg ⟖% f&jpg e vZg vLgfv b  wbg  Xg 7 vflf 7 df Zf fʶv J%  7 :f 2f `fv % f&v Je  ʣ £e` ~ t j ` V L  | r  fv &  we _   E m &f x  8  b_ ( ΡeEeبe* E  E &f  < b mfv j  Mfv % f&v e  P Ev eE  v& f  vɋW Error from device assignment Kermit-11 no longer running in LOCAL mode Link device: Speed not settable Speed: DTR/CD not currently present DTR/CD present Bad value for speed or speed not settable Please use the SET LINE command Please use the SET LOGFILE command first Log_file closed Can't do RAW i/o disk logging with other DEBUG options set Old logfile closed and new logfile created in BINARY mode Can't do disk logging with RAW i/o logging on To enable: Connection logging SET DEBUG CONSOLE File opens/creates SET DEBUG FILE Packet traffic SET DEBUG PACKET Raw terminal i/o SET DEBUG RAW State transitions SET DEBUG STATE Connection logging can be controlled by typing your escape character followed by a R to resume or a Q to stop logging. Kermit-11 will have to request 8 Bit quoting for the transmission of binary files. If the other Kermit does not support this, information for binary files will be lost. Unknown parity SET DUPLEX HALF, SET PARITY MARK, SET HANDSHAKE XON done SET DUPLEX FULL, SET PARITY NONE, SET HANDSHAKE NONE done SET RSX TC.DLU value, where value is 0..2 ?Error - SET RSX CON [DEF][ALT] %SET-W SET RT11 CREATE_SIZE decimal_value %SET-W SET RT11 FLOW [ON][OFF] %SET-W SET RT11 BREAK [SHORT][LONG] %SET-W Unknown option in SET DIAL Insufficient space to contain string Insufficient space to contain string No space left for numbers ALLCONSOLECONNECTFILEHELPNONEOFFONPACKETRAWRPACKSTATETERMINALNOTERMINALEVENODDMARKSPACENONENONEXONXOFFCARRIAGE-RETURNCARRIAGE_RETURNFULLHALFONOFFONOFFCHARIOLINEIOTC.DLUCONNECTFLOW_CONTROLNOFLOW_CONTROLNOVOLUME_VERIFYVOLUME_VERIFYCREATE_SIZEBREAKOFFONNONETIME_OUTServer_Idle timeout? NOTIME_OUTTIME-OUTServer_Idle timeout? NOTIME-OUTDEDICATEDNODEDICATEDDETACHNOEXITEXITWAKEUPString: WAKE_STRINGString: PROMPTString: INITIATEString: FORMATString: SUCCESSConnect acknowledge: INFORMATIONRinging acknowledge: FAILUREFailure acknowledge: CONFIRMString: WAKE_RATEDelay in milliseconds: DIAL_RATEDelay in milliseconds: DIAL_PAUSEPause character(s): TIMEOUTTimeout in seconds: TIME_OUTTimeout in seconds: NUMBERName and phonenumber: JvvZ  J°ȢưȰPΰаְذfn~ ؤܤ 02BD IJOPST XZD]^fbdklst{|880(ıƱұԱڱܱbfb Ч!8ЧCDڧNP\^efmn&st{ò̲Բʨ Ҩ*2<F^ܨh𨨳dzܳ0E?w5wf  Ew ¨ vwƨ  쫱f̱n %  1y1y2y2y3y3yy f bm  &   n jf Dm  &  Hf&  e , $fhm .%  mȋ fh& %  x Ȫ" m ׭m& ` d    ~ vbx hʩ ` tm 7 lm 7 m m f@ l.ӕ.    Ω     z " ةT Щ7zzD H e@`lt fH "% X z& 7ln ff& t e J JUNK.DAT7ll 0 ( @kfk Ɣe fk e & tUtk: Ī j f& jk ^eƪ ʪ   ~ v  4 $ ^J V  N @p 8fj D% f&j xe vj vj * wj  wj  wjw~jfzj    W t  fDj ܨ  w(uwDu f$j B  wjf j (  whjXi ة   Di  f >ƫ fi ڧ  ^W `wtwt7 jC ̑ XXW XXʫ  f  , @ h0 j & n v n fά ^iwxi _f d7-t7sw&tws wswsfh  W W ` Ҭ  쥱MAXfh 4  EW  ¥> whfjh  ,W  B d wjhf8h V  W W < h X Pw sw'sfHg P%  7 <4.&flg %  7h flg %  7g 7 g 7 g fg fTg r  wxgf6g %  7Vg f̴ g d%  7Xr ff 8%  7f fDf %  7 oo&ff&  nbf& f \eeDebug file closed Please use the SET LINE command HANKERMIT link disconnected Ascii text mode set The other Kermit must be able to support 8 bit prefixing Without this feature, the high bit will be lost on every character sent Binary mode set The filetype must be of the form .xyz as in: SET BIN .SAV or SET BIN .TSK The default binary filetype list has been deleted Error from $PARSE - Directory for files set to Directory set back to none (SY:) Opened Log_file Kermit-11 supports the LONG PACKET extension. It does not support SLIDING WINDOWS %SET-W Unknown option in SET RECEIVE %SET-W Unknown option in SET SEND The SOH character must be between 1 and 36 octal Receive buffer size set to This size exceeds Kermit-11's internal buffering of bytes. It has been reset to that value This packet size exceeds the host's input buffer size of bytes. This may cause the line/port driver to loose data at rates greater than 2400 baud. The packet size must normally be in the range 20..94 The escape character must be a control character RETRY should be between 3 and 30 TIMEOUT should be between 4 and 60 1_CHARACTER_CHECKSUM2_CHARACTER_CHECKSUM3_CHARACTER_CRC_CCITT1-CHARACTER-CHECKSUM2-CHARACTER-CHECKSUM3-CHARACTER-CRC-CCITTONE_CHARACTER_CHECKSUMTWO_CHARACTER_CHECKSUMTHREE_CHARACTER_CRC_CCITTONE-CHARACTER-CHECKSUMTWO-CHARACTER-CHECKSUMTHREE-CHARACTER-CRC-CCITTSUPERCEDENOPROTECTNOSUPERCEDEPROTECT7_BIT7-BIT8_BIT8-BITASCIIBINARYEIGHTSEVENEIGHT_BITSEVEN_BITEIGHT-BITSEVEN-BITFIXEDIMAGEAUTONOAUTOTYPETEXTTXTEND-OF-LINEEOLN char ? PACKET-SIZEPacket Length ? PACKET-LENGTHPacket Length ? PAUSEPause time ? START-OF-PACKETOctal valule of SOH ? START_OF_PACKETOctal valule of SOH ? TIMEOUTPacket timeout ? END-OF-LINEEOLN char ? PACKET-LENGTHPacket Length ? PACKET-SIZEPacket Length ? PAUSEPause time ? START-OF-PACKETOctal valule of SOH ? START_OF_PACKETOctal valule of SOH ? TIMEOUTPacket timeout ? STREAMVARIABLEOFFONNONEOFFONNONEOFFONTTYVT100VT101VT102VT200VT2208-BIT7-BIT8BIT7BIT8_BIT7_BITPASSALLvҭԭvv/0GHbdv{|ƮȮԮ֮ޮjjjj *,j68BDjNPVX^`efmn:stjyzj~ƯدԤޯ^^$<DVbp~Ԥ°PҰP,34&=>BDGHMNRTWX]^ bdgh6ln:tv:|~:@@jdjdjd±jʱ6 0fv B%       J   R   8 |  N   h    Zw  , 70 f& : 4e @ l !f& &( e7<w D BL :P 0Z ( 0KfRemote connection logging File opens and creations Packet logging to logfile State logging to logfile $v ^ z ~ f&  .e h `f k f&f eff ޙeeʬ Ь f` .g%f& ` ef&  ef` f%f& ` deԬ f` f%ج |f& ` &e `f` f% Bf& ` e & Llf& t e, 0 6 訇: ި ѕTf& f "eeѕ.f& 1f eff &ef&f 2ef& ] eF Xe ׭@v J B` : ׭&vd ( j  u11 f& &^ ed{1-Character-Checksum 2-Character-Checksum 3-Character-CRC-CCITT |je@f­ |ff &e `  Tuf&   : 2 *tf& & %8 < tf& & 쥖%Z ^ f& i ʥ%| ȦPf&  le   V1AHѕ  e@UՋeT  t  Е Е f& & ee f& ئ ڕe  >  .    ֥ eP  ~df& & ne` @ ^de Type Last Sent Last Rec Tot Sent Tot Rec Total character count, less packet framing, but after data formatting (ie, includes repeat compression and prefixing) from last transaction. ^rXrmZr@ mRr`rf c f& & %Ү  "rrmr@ mrrf b df& & N% L D :f& bg "%4 8 f& &  ^44 f f hl f ke *f j f bl  f tke f 0l w> lk f vk% l )& N v KW f `ke       f j% <KEwlf j% *Ewl  6  f je ll f je  f %w& f j%f Vi f i% ie&, *f`& *f%` ħe`Е Е ` f&` ie & :fŀ& N ңCcIiQqRrXxBb?Hh,,66HHxxxf Vie f i  Es 5sUs fv ief i  f i%  f& he B Try to send a break to the remote C Connect back to the local Kermit-11 I Drop and raise DTR (for RSTS only) Q Quit console logging. See SET LOG R Resume console logging. See SET LOG X Send XON and cancel any active XONs RUBOUT Try to fake a break to the remote ? Print this message 5r 5r &f@ ڔ t f @ge t f geYou must first define an output port: Use the SET LINE command for this. Connecting to line at baud Type CTRL and then C to return to command level Bvzˋf  D  0 +ʋ 4 X \ f&  ed Ы 6 n& 6   j_v   L_ vz v h l dXv n׭vX ׭vT   0 (: Z 73, 4ȋ   !f ke  l   & l & L  ^^&f bk% L SD   H T" L& D, <0 4f&  ڙe f& v e f& ( e4 ک ׭m0׭m91P-eע Дv 6  ˋv 8 nf& v e@ Rf& f@  f&f 6je&     D Z t ^ Ҩ~ ʨ &fX Z T *k*f2@ x f&f ief4@ N f&f nief@ & f&f Fie&  r ˋ1 s& Ԁf& ie & f h%   f& %& f ◖% 0f @ \ f&f |he&" J  > 6 M  k (jf.@ f&f hef0@ ¥ f&f ge f& 찅 ^e   f Ȗ% ` hh5  4 )fh g% ŀS $W W ȳ&  < ̳  e*:e  0-  "C f@ V f&f vfe& Dð x ˰ d ְ P ۰ <  (  - ̤ Ĥ "C f@ f&f ee& ~  ʋ%vsS pWP   & f d% ŀB %f  Z  L zff& e%&ff Zd% &ȋ AZ Invalid number for retries No previous number has been defined Using: Please use the SET LINE command first Please use the SET MODEM command first A dial formatting string has not been defined This modem type is unknown. The known modem types are: Using: Modem in command mode Failed to get modems attention Modem dialing Call failed Connection made, use the CONNECT command to access remote Remote is ringing Remote phone is ringing NF#NacfhQlpSnwlSS#­SƭSڭSͭܭαխ׭SS# S4'60/1SSRXSSS[SSSSSSS^SSSS.x~SSSSSSSSSSSfSSSSSSSS®SSS׮#ޮSSSSSSSSSS֬# SS"SSSSSS'RSSSS7 <>_ackASoSSSwtSSSS SSSSSSSSSSSSS =SSSSVA212PA HELLO:I'M READY*D ?%s ONLINEDIALING I KStand alone VADIC VA212VA212PAR HELLO:I'M READY*D ?%s ONLINEDIALING I KRack mounted VADIC VA212PARVADIC HELLO:I'M READY*D ?%s ONLINEDIALING I KGeneric VADIC with autodialDF03%sDEC DF03AC Autodial modemDF100ReadyReady%s# DEC Standalone DF112DF200ReadyReady%s! DEC Standalone DF224HAYESATZ V1 OKOKAT D %s CONNECTMICROCOM4445 SE2 S1C0 SCE ON !!D%s MicroCom SX1200R212A RIXON R212A INTELLIGENT MODEM$KNUMBER:%s ON-LINEDIALING:RIXON R212A Intelligent ModemPROTMSUSER_DEFINED No connection Excessive RINGING... messages returned Operation aborted under user interupt No response or invalid response to dial commandCONNECTNO CARRIERBUSYERRORRINGABxON LINEONLINEBUSYFAILED CALLNO DIALVOICE±TIME OUTRINGINGڱON LINEONLINEBUSYFAILED CALL NO DIALVOICE$TIME OUTRINGING<ON LINEHONLINERBUSYbFAILED CALLnNO DIALxVOICETIME OUTRINGINGAttachedBusyDisconnectedƲErrorԲNo answerNo dial toneSpeed:Attached BusyDisconnected&Error4No answerFNo dial toneSpeed:^CONNECTnNO CONNECT!ON LINEON-LINENO ANSWERDEAD LINEBUSYEND DRINGINGȧH X ! .& ¨H L l f \% Diwv7 R7 L7 ͋ 7 n  j * p  7 n 1 ~ Mv B *   & Э  Pf&  ef& "m  f<f& e 0&&& w &f" ͋W   ͋W T&ff 17x E m= f& %  .1$ ̋!  Cע*ˋ̋az  " rf b &f"& N lWf& % J1 7B& 8 8 "& &&  b rf& & e V78̋ f& & e 4 &f& & tW1 f 7D ڨܥ Ҩ ʨ ¨ &7 k̋ f& ĕ% 91 kC /5,-4 &  T   f&  e 6 f&  Зe %f Ɣ    ff e   jä֤LB:[1,2]K11HLP.HLPSY:[1,2]K11HLP.HLPKERMIT:K11HLP.HLPHELP:K11HLP.HLP DK:K11HLP.HLPSY:K11HLP.HLPI can't find the Kermit-11 help file, error Printing default internal help Help not found for the requested topic Additional information is available on: Topic ? N 07 ndpfv 8% , '7 n n  &n f&  e & zf l% ` 7 xn  , *w0 J ؜ @n & N t l^yZyLn7 Py7 Hy7 Fy7 fn,:Pm7 Nm1"nn$y y gnnff f%BCAe7 m&& N X F f : 7 mxn fn&xE e  xf:OxN je nxf g%f f f,m>xY "e ZmZm xf f%f f flwY ̀e Dww7 ww  @ hwfF pc  ll&  f l 7 o . fS c  3f 6%  f`& jf%` f`&wE e  ȴ j Spawned job failed due to timeout or TT read wait f >%Mq2& N \ jf&lvE Pe f:OJvY .e Vj h 7 @j% f&vE ~ef L%f i 3f:OuY ~e 5fsf  > ^Ф zfФ&|uE `~e Logout failed - Quota exceededServer disconnected and still logged inPff  @ ff&tY }eeP & N $ft @`ԥ 0f D f&tY }ee` vf&xtY \}e Default directory set to Need a directory name to change to& N  H>ff ,c%&   , && ` ` ¤e`& & ʧ` f`&sY |eȴ  deleted& N  ff ` ff Vb   &< Xg:O #FgBg:O The following commands are available for the Kermit-11 server. To avoid ambiguity with local Kermit commands some of the server commands will need to be prefixed with the REMOTE keyword. BYE Logout Kermit-11 REMOTE COPY Copy one file to another REMOTE CWD Change default directory REMOTE DIR Prints the directory out REMOTE DISK Prints available space REMOTE ERASE Deletes the filename(s) FINISH Exits a Kermit-11 server GET Sends the filename(s) REMOTE HELP Prints this help text REMOTE HOST Execute a host command REMOTE LOGIN Login. RSTS V9.x only REMOTE RENAME Rename old file to new REMOTE SPACE Prints the disk space REMOTE TYPE Prints the filename(s) REMOTE WHO Shows users logged in ɋ& N f& `%@ I need a filename to TYPE ,f  f %  ȴ > SYSTAT failedP  ff e  hf&joY Nxe f % ePLogin successfulMissing password or UIC (PPN) :ff ,^e *(ff >ee&  ̢ f&nY wee(  n fӴ …% blocks copied j:ff z]e *(ff ee& ^ * f&nY vee(  fӴ % file(s) renamedf`tP ȴPf` de &f`& \%f` e Can't create KERMIT.TMP f   f`& f\%f` D% &ˋ& aˋ & #7 l fޭlG ueff x%BCAeWY f % FCan't get the remote KERMIT to FINISH 7 ,l flG teff Rx%BCAeWYWE f % f % 蒇LCan't get the remote KERMIT to LOGOUT V >W7 vkv `fv&bkR FtefR W  x  V7 0kv fv&kC te f:OU ^e ffD Be ffT &e f:OW e ffE e f:OH e fffR e fffK e @ȋfffC fe ffC Le @ȋfffI $e ffI e 7 iXJ A@ l& e  f nW-ҋ@ B & e  f @f&& x~%EeX  T7 i7 if&fiG qeff 8u%BCAeh& N *  7 h7 h ENSYXT~fұ$V h-hL zt r ^h-Zhf&fNhG 2qex 8 0 h-hf&f hG pe  gg ڙԶ ҙfF S 7 g7 gض ܶ  f 8V%f V fP\bgY FpeJg  @ W4gfF R    f&  ef&   e f ~% f }% Can't get the remote KERMIT to respond& & x7z]7 z^\ "  ,^ffF Q 7 Jf7 Df ,:@Z7 >Zf X fX& fE ne f Y%Init failed for link?Kermit-11 Unimplemented server command?Kermit-11 Unimplemented server generic commandKERMIT.TMP?Kermit-11 Invalid arguments for remote server command SERInvalid SERVER subcommand Server detaching from TI: You must use the SET LINE command before detaching the server Kermit Server running on PDP-11 host. Please type your escape sequence to return to your local machine. Shut down the server by typing the Kermit BYE command on your local machine. Remote fails to respond to the command Remote NAK'ed the command 5 times Bad checksum retry abort Remote server response Receive data failed Remote ack: DETACH SRGITNYCEIFCLDUESWMHQRKPPJVTpơ袜T@̫*T  w $zf m f le f l f zm  ff e i ncf  Y f %f l%W f %f @l%(fff @le  xf l%  XTL & t f  f k%f j Zv07f& ff  *   6e     ҫ΢ ʫҢ «&f&ff& f VeD f& & :(46@88pTP`2Nb`:Tlnd^,. D6"<4NtDRFHP PBP   <($IMAGEALTCONARGBUFARGPNTAT$ACCAT$AREAT$BILAT$BSIAT$CREAT$DISAT$ENCAT$FABAT$FORAT$IDAT$LENAT$PASAT$PR0AT$PR1AT$SYSAT$TYPAT$VALATRCTXBINMODBINTYPBSDBUFCCCNTCHARIOCHKSIZCHKTYPCMDADRCMDBUFCMDLUNCMDNUMCONESCCONPARCONSAVCONSTSDO8BITDOLONGDOATTRDEBUGDEFDIRDOAUTODO8BITDORPTDUPLEXEN$SIZERRTXTFILNAMHANDCHHLPBUFIMAGEINDEXINOPNINSERVJOBTYPKBIOSTLINKSTLOGFILLOGSTRMAXTRYMCRCMDMODEMNUMTRYOLDTRYOUTLUNOUTOPNPACKETPAKNUMPARITYPAUSETPCNT.RPCNT.SPNHEADPROCTYPROFLGPROMPTRANERRRECCNTRECPARRECPKTRECLNGRECWINREMOTERPTQUORTQUERTWORKRTFLOWRTVOLSDBUFFSENCNTSENDATSENDLYSENLNGSENWINSENPARSERMODSERTIMSERWAISETRECSETSENSIZESKIPFLRECSOPSENSOPSPARSZSRCNAMSTATESY.INITCDLUTESTCTIMESTISTSTMPERRTOTP.RTOTP.STSXFLGTRACETTCONSTTDIALTTNAMETTPARMUMDDEFVTTYPEXGOTTNXMODE`f&BD   E f 8J`A   f PJ < DԐ &@ȋ. Õ. f&@fff L%@ j )`W. "@ R DˋD 8  0 ( e e@az DD hfAB ɋ& N >r ʝJ  f&v”;\< ”/> 0)7&0 `B & ’0 7 0 `  T‹   jlrx.TSK.SAV.OBJ.STB.CRF.TSD.BAC.OLB.MLB.RTS.EXE.BIN.SML.ULB.HLB.SYS.LIBX0123456789.abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZf&YDY  ͷ Y @    7 Y "|x&  Js ԕ.ԕ"ԕD  89A8BCff x|% ԕ0ԕmMЕ  f& %e  ԕ"ԕ!̕A׭DY̕I4 ff x   Eԕ!ԕ%ff& he ̕0  f&fE@#A!.WDM < R f &  r ΅  &!  M @ Ze  f7 Y ʋ & 0 f ^He  whY f&&f 7 PY  ͋W  IC& N0eB  IY  Y ׭ B׭ IWX X X F XA X @ 8 M( P $C 3f  Te X 7 fX  ׭FXD& 9X @p7 X7 X7 X7 X7 X7 X7 X7 X7 X7 X7 X7 W7 W7 W7 W7 W7 DVf  W׭W W"W,fff 0y%7 W7 W7 W  J V p8VBK6K(K"J | <JvJJJJ1J1U1UJJJ&  dS fJ^J `JRJ7 HS6JKermit-11> f Xre .K&J&f J dJ XJ JB7 ,UYTN7 UY׭I &1TT7T1& Ne & Ne & Ne & N n& Ne RRRR I I& Ne & Ne & Ne & Ne /T ׭)T1׭!T3TSf I ZI NI Iѕ^ѕ ѕѕѕ ѕ#ѕYɕ1 ɕ Tɕ~ ɕ I H ^ _ Dѐ&S&f& A@& N Q& N J& N C& N l <& N 5R 2R /R ,R )& N ҵ & N *H & N ŀ_ C & N ŀa ŀ  v1wCRRR7 RWY&R WN7 pRjRwjR7 zG xG  bGZG-VGXXLG DG BF Q QfP h%%Warning - You have requested LONG packet support but the other Kermit does not support this feature. fѕ^ѕ ѕѕѕ ѕ#ѕYѕ1ѕ ȋȕ^ ȋȕ ȋȕ ȋȕ ȋȕ ȋȕ# ȋȕY ȋȕ1 ȋȕ &f5N4f  Xq% @ f& 6q%A@ f& q%f  q%Receiving file Sending file &f&fPPѕ @  Bff ree Qѕ W* ѕ ѕ ѕ $ @f&f &ee fFf *oeC HHf& oeeHH "Mf& f qe jq ff pe PqePLengthTypePaknum ѕ ѕ fN7 |N|N7 vN 0 f& υ peCfJN7 DNDN7 >N  f& υ ZpedCf .M 0Cf > 0C BЁ pf& 1Ѕ pew,MwM Ff& /Ѕ oe `, B Bf& "Ѕ oe w,nMwfM F \f& /Ѕ ~oef L ZBf > ZB 4ЁT f& 1Ѕ 2oew,LwL pf& /Ѕ oe B :f& "Ѕ neT 4w,LwL v  f& /Ѕ ne&f =f& & nee׭vA \A L Lf& ͅ @ne 4w,KwKf& ͅ ne ` J!"#$%&'()*+,-./01¢¦ª®²¶º¾Unknown attribute packet type ?K11-ATR Protocol bugfix detected. Use SET NOATT and see K11.BWR, K11INS.DOC. Fab attribute error 89ABC SY:KERMIT.INILB:[1,2]KERMIT.INISY:[1,2]KERMIT.INIKERMIT:KERMIT.INI< Packets sent : Naks: Timeouts: < Packets received : Naks: Timeouts:  /"lf& ff ,  7 7 v  7       &7 Г7 Гffwf % 7 T   &7 nfNT ލ7  JT? J& T? .  7 ֓7 ʓTƓ?“>NTt jTfTNT e ; T F f&  e3 T  f& % T   |MPtf& : q ɔ @ W:ѕ*ѕ.ѕ*ѕ= ffF0ff ,{  5<Ƒ @>T@  @  p O OP P* `@edr0 (r7(e׭(& WDECR T11 * Ppr0 "r7 e7 7777l * Pf  ST M v Kre 5>57  3 ^ nf& ˅ ve7Z J B  f&˅ <%  m̏"&f    .v  f&   E e6ѕ-єєєѕ-EeH   e e0e0ѐJan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 00-XXX-00rŇATTRIBUTESOn or Off ? BAUDSpeed for remote link ? BINARY-TYPEBinary file type ? BINARY_TYPEBinary file type ? BLOCK-CHECK-TYPEType ? BLOCK_CHECK_TYPEType ? CONSOLE7 or 8 bit ? DEBUGWhat: DEFAULTDirectory ? DELAYSeconds to wait ? DIALOption: DIRECTORYDirectory ? DTRDUPLEXHalf or Full ? END-OF-LINEOctal value ? END_OF_LINEOctal value ? EOFExit or NoExit ? ESCAPEOctal value ? FILETYPEBinary or Ascii ? FILE_TYPEBinary or Ascii ? FILE-TYPEBinary or Ascii ? HANDSHAKEType ? HAND_SHAKEType ? HAND-SHAKEType ? HOMEIBMON or OFF ? LINEDevice name ? LOCALLocal echo ON or OFF ? LOGFILELogfile name ? LOG_FILELogfile name ? LOG-FILELogfile name ? LOGOUTLogout string ? LONG_PACKETSLong Packets ON or OFF ? MODEM-TYPEModem type ? MODEM_TYPEModem type ? NOATTRIBUTESNODEBUGNOLONG_PACKETSNOQUIETNOUPDATEPARITYOdd/Even or None ? PAUSESeconds to delay packets ? PHONEOption: PROMPTKermit Prompt ? QUIETRANDOMOn or Off ? RECEIVEOption: RECORD__FORMATStream or Variable ? RECORD-FORMATStream or Variable ? REPEATTo: REPEAT_CHARTo: REPEAT-CHARTo: RETRYNAK retry count ? RSXOption: RT11Option: SEEDRandom seed ? SENDOption: SPEEDSpeed for link ? SERVEROption: START_OF_PACKETOctal (1-36) ? START-OF-PACKETOctal (1-36) ? TERMINALType ? TIMEOUTTimeout ? TIME-OUTTimeout ? TIME_OUTTimeout ? WINDOWUPDATEUpdate interval ? \ %>J^j~$4 ,02L9J$Vf$r<<<#,<7@EFTJX]lDrld!0;JlWX,`btqrdz|t4,|\ T)@TNdkr~D *:JZclLtLL|x~ÇŇ@Command file ? BYECOMMENTCONNECTCWDDirectory: COPYFrom: DATEDELETEWhat: DIALPhone number ? DIRECTDISCONNECTDISKDISPLAYSymbol: ERASEWhat: EXAMINESymbol: EXITFINISHGETFile ? HANGUPHELPHOMEHOSTCommand: LOCALLocal command ? LOGOUTLOGFILELogfile name ? LOG_FILELogfile name ? LOG-FILELogfile name ? NOTEQUITPRINTFile ? RECEIVEREDIALNumber of retries ? REMOTERemote Kermit cmd ? RENAMEFrom: SENDFile ? SERVERSETWhat: SHOWWhat: SPACESTATSYSTEMCommand: TAKECommand file ? TESTTIMETRANSFERFile ? TRANSMITFile ? TYPEFile ? WHOBYECOPYFrom: CWDRemote Directory: DELETEFile Specification: DIRECTORYOf what: DISKERASEFile Specification: FINISHGETFile Specification: HELPHOSTCommand: LOGINUser and Password: RENAMEFrom: SPACETYPEFile: WHO A$&A.08:E>JOV[\cjoAAAF  E"A)*2BK\evA{|A:?fE? #.3DEIJOPYbktyACCBBrBBA A&B+,B1<TCBVC]drBjlBqxB|~& t@ ,@ 'tqW$@ : t 2 * $P    'f& f ^{ef&  J{ef& f 6{ef&  "{e renamed to & t@ %tW$@ \ t 2 * $P    f& f zef&  lze deleted fP& : q t = fjfFSSSSeP* OePf& |{   ff te Iff ue 2f w  ff >x%     &f lv f \v f Hv &fAW-& f B,@ E E > E eѕ-єєєѕ-EeH   e e0e0ѐJan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec 00-XXX-00&f) d&< ZA 2ѕ: (ѕ:f < 6  %  e e0e0ѐ & A @    fff e&f~@@  # @fP%~(f& f& :eeЕ)Е Unknown error callMissing executive feature +:GSaGf…§ ESqÐî1O{Ĝ~Can't create fileInvalid device nameEnd of fileFile not foundBad filenameDevice fullNo more filesInvalid i/o operation requestSystem errorLogical unit already openDevice read errorDevice write errorFile is protectedRecord too large for user bufferNo QUE elements availableMT service - No data available/Buffer overflowMT service - Line not attachedMT service - Non-existent unitMT service - Device not availableMT service - Bad user buffer address (XM)Multiple Terminal Service support not present in executiveMT service - RT11 device unit not mapped to internal LUNUnknown speedSystem error from RT11 .CLOSESystem error from RT11 .CSISPCSystem error from RT11 .ENTERSystem error from RT11 .FETCHDisk home block is not RT11 formatI/O channel not openWildcarding not supported for this operationCould not open the XC/XL portInvalid function code to .SPFUN for XC:/XL:Hard I/O error on device XC:/XL:Insufficient lowcore memory to load handlerUnknown serial line device name^ 6b .~ & @  @@ff {ee@@ 䋇 Default Kermit-11 help text BYE CONNECT COPY CWD DELETE DIRECT DISCONNECT DISPLAY ERASE EXIT FINISH GET HANGUP HOST LOCAL LOGFILE QUIT PRINT RECEIVE REMOTE Send a command to a remote server BYE Remote logout COPY Copy file1 file2 CWD Change working directory DIRECT Remote directory listing ERASE Remote file deletion FINISH Exit remote Kermit GET Get file(s) from server (see GET) HELP Ask server for HELP HOST Ask server to execute opsys command RENAME Rename file1 file2 SPACE Inquire about disk space and usage TYPE Ask server to type a file WHO Request a list of who's logged in RENAME SEND SERVER SET Set parameters. See K11USR.DOC ATTRIBUTES BAUD BINARY-TYPE BLOCK-CHECK CONSOLE DEBUG ALL CONSOLE CONNECT FILE HELP NONE OFF ON PACKET STATE DELAY DEFAULT DUPLEX END-OF-LINE ESCAPE FILETYPE ASCII AUTO BINARY FIXED NOAUTO PROTECT SUPERCEDE TEXT TYPE HANGUP HOME IBM-MODE LINE LOGFILE PACKET-LENGTH PARITY PAUSE PROMPT RANDOM RECEIVE END-OF-LINE START-OF-PACKET RECORD-FORMAT RETRY RSX RT11 CREATE-SIZE FLOW-CONTROL VOLUME-VERIFY SEND SPEED START-OF-PACKET TIMEOUT TERMINAL UPDATE SHOW Display current parameters ALL BLOCK-CHECK-TYPE DEBUG DEFAULT ESCAPE FILE-TYPE LINE PACKET PARAMETERS RECORD-FORMAT TIME VERSION SYSTEM Execute local operating system command TAKE Execute an indirect command file TYPE Type a local file WHO Display user's on local system Note that KERMIT-11 will accept wildcard file specifications for both the SEND command and the Server GET command, as in SEND *.MAC or, from a local Kermit talking to Kermit-11 as a server, GET *.MAC